PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000177126
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family CO-like
Protein Properties Length: 415aa    MW: 45416.3 Da    PI: 6.5612
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000177126genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.12.7e-06443538
       zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                   +C+ +++++   +C++++ +lC +C  + H+       H+
  MDP0000177126  4 MCDFCGNQRSMVYCRSDDACLCLSCDRNVHSAnalsrrHS 43
                   6*****************************5566666676 PP

2zf-B_box23.98.4e-084489241
       zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                   ++ +C++++++++   C++ ++ lC++C    H+       H++++
  MDP0000177126 44 RALICDRCNSQPAXVRCTEERMSLCQNCDXMXHEXstsasmHKRQT 89
                   5679*****************************7788888888765 PP

3CCT58.52.3e-20356399144
            CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                    R +a++RYkeK+k RkFeK++rY+sRKa+A+ R+RvKGrF k+ 
  MDP0000177126 356 RSNAVMRYKEKKKARKFEKRVRYASRKARADVRKRVKGRFIKAG 399
                    899*************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.84147IPR000315B-box-type zinc finger
CDDcd000213.53E-8447No hitNo description
SMARTSM003365.9E-10447IPR000315B-box-type zinc finger
PROSITE profilePS5011910.044390IPR000315B-box-type zinc finger
CDDcd000214.02E-54790No hitNo description
SMARTSM003360.394890IPR000315B-box-type zinc finger
PROSITE profilePS5101715.269356398IPR010402CCT domain
PfamPF062031.7E-15356398IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MGYMCDFCGN QRSMVYCRSD DACLCLSCDR NVHSANALSR RHSRALICDR CNSQPAXVRC  60
TEERMSLCQN CDXMXHEXST SASMHKRQTL NCYXGCPSSA ELSSIWSFVS ELPSNGESAC  120
EQEMGLMSIA DNSTATDWNQ SESNTRQNAS GADEVNAAHS MHKSGVLVGS PSLPERNHAR  180
HVVGQLSGSV NASLPKLYSH GPKGSGLPED DDLYDGFDMD EMDLNLENYD ELFGVSLNHS  240
EELFKNGGID SLFGARNMCR NYQDAVAAEG SSVGLGNTPQ PACSNAASAD SVMSRKTDPI  300
ICFPAKQAHS NLSFSGVTGE SSAGDCQDCG ASSMLLMGEP PWCPPCPESS MQSANRSNAV  360
MRYKEKKKAR KFEKRVRYAS RKARADVRKR VKGRFIKAGE AYDYDPLNQA RTRSY
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.20370.0fruit| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008380027.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like isoform X1
SwissprotQ9SSE51e-153COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLD9ZIX50.0D9ZIX5_MALDO; COL domain class transcription factor
STRINGGLYMA20G07051.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43623353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.41e-118CONSTANS-like 9